PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_139238g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 545aa    MW: 60735.5 Da    PI: 5.872
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_139238g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-173380148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+lv+ ++++G g+W+++++  g+ R++k+c++rw +yl
   MA_139238g0010 33 KGLWSPEEDEKLVRHITKYGHGCWSAVPKQAGLQRCGKSCRLRWINYL 80
                     678*******************************************97 PP

2Myb_DNA-binding45.91.3e-1486129146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E+ l++++++ lG++ W+ Ia +++ gRt++++k+ w++
   MA_139238g0010  86 RGTFSPQEENLIIELHAVLGNR-WSQIATHLP-GRTDNEIKNLWNS 129
                      899*******************.*********.*********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-272583IPR009057Homeodomain-like
PROSITE profilePS5129418.5312880IPR017930Myb domain
SuperFamilySSF466891.91E-2931127IPR009057Homeodomain-like
SMARTSM007172.5E-133282IPR001005SANT/Myb domain
PfamPF002493.7E-153380IPR001005SANT/Myb domain
CDDcd001679.85E-123680No hitNo description
PROSITE profilePS5129425.47981135IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-2584135IPR009057Homeodomain-like
SMARTSM007173.9E-1385133IPR001005SANT/Myb domain
PfamPF002491.3E-1386129IPR001005SANT/Myb domain
CDDcd001671.43E-988128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MDCSTSGPSC IEEWELRRVM GRHSCCYKQK LRKGLWSPEE DEKLVRHITK YGHGCWSAVP  60
KQAGLQRCGK SCRLRWINYL RPDLKRGTFS PQEENLIIEL HAVLGNRWSQ IATHLPGRTD  120
NEIKNLWNSC IKKKLRQRGI DPSTHRPLSE VNAEAGDSKN DNSNKKIETQ AVMDESHVSA  180
GNEFKHPNAI PRAETGNPKF FHVPVEDNNL IASDSQAMLH NGFINSNSTT TTATSTASAA  240
NISLPKEFFL ERFNSVNATP TSVEPGFNFI NQTSCTQGFT AERDHKLIDN PVLWVLQAPS  300
RSVGFPTENL MPWPGQVPAK AVSDAFSDFS SDVCDYNSIM ANPSMYRPGP CLSSLLYSER  360
SLDQDLLDNA GTNCMNGSAV GSAQYWDNTE NNNVRTSSRS SSCNSSTANL EVNNGAAFGH  420
FWGFGERLDA TDITSENERK APLFLERAET EYAVKWSEML PPFSSHTQEE TLPMYITTDS  480
KSQDLVSSDN INNHNQGALN SAIFPISWQQ LQNTEYPVLG DRTTMLSTPL SDPDFHRIAA  540
VLDQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28311355108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6010710.0EF601071.1 Picea glauca R2R3-MYB transcription factor MYB8 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA5JYF20.0A5JYF2_PICGL; R2R3-MYB transcription factor MYB8
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-86myb domain protein 55